| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (159 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [225273] (5 PDB entries) |
| Domain d3fwnb1: 3fwn B:2-176 [210245] Other proteins in same PDB: d3fwna2, d3fwnb2 automated match to d1pgja2 complexed with 6pg, atr |
PDB Entry: 3fwn (more details), 1.5 Å
SCOPe Domain Sequences for d3fwnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwnb1 c.2.1.0 (B:2-176) automated matches {Escherichia coli [TaxId: 83333]}
skqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefv
esletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfn
figtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigad
Timeline for d3fwnb1: