| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (23 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [225711] (3 PDB entries) |
| Domain d3fwna2: 3fwn A:177-468 [210244] Other proteins in same PDB: d3fwna1, d3fwnb1 automated match to d1pgja1 complexed with 6pg, atr |
PDB Entry: 3fwn (more details), 1.5 Å
SCOPe Domain Sequences for d3fwna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwna2 a.100.1.0 (A:177-468) automated matches {Escherichia coli [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdayaenpqianlllapyfkqiaddyqqalrdvvayavqigi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewld
Timeline for d3fwna2: