Lineage for d3fwna2 (3fwn A:177-468)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276523Species Escherichia coli [TaxId:83333] [225711] (3 PDB entries)
  8. 1276524Domain d3fwna2: 3fwn A:177-468 [210244]
    Other proteins in same PDB: d3fwna1, d3fwnb1
    automated match to d1pgja1
    complexed with 6pg, atr

Details for d3fwna2

PDB Entry: 3fwn (more details), 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d3fwna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwna2 a.100.1.0 (A:177-468) automated matches {Escherichia coli [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdayaenpqianlllapyfkqiaddyqqalrdvvayavqigi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewld

SCOPe Domain Coordinates for d3fwna2:

Click to download the PDB-style file with coordinates for d3fwna2.
(The format of our PDB-style files is described here.)

Timeline for d3fwna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fwna1