SCOP 1.63: Domain d1fdlh2: 1fdl H:117-218

Lineage for d1fdlh2 (1fdl H:117-218)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab D1.3 (mouse), kappa L chain [49005] (2 PDB entries)

8. Domain d1fdlh2: 1fdl H:117-218 [21021]
   Other proteins in same PDB: d1fdlh1, d1fdll1, d1fdly_

Details for d1fdlh2

PDB Entry: 1fdl, 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdlh2:

Sequence; same for both SEQRES and ATOM records:

>d1fdlh2 b.1.1.2 (H:117-218) Immunoglobulin (constant domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
asttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1fdlh2:

• d1fdlh2 first appeared (with stable ids) in SCOP 1.55
  
• d1fdlh2 appears in SCOP 1.61
  
• d1fdlh2 appears in SCOP 1.65
  
• d1fdlh2 appears in the current release, SCOPe 2.08