Lineage for d3fuda3 (3fud A:461-609)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500776Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 1500777Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 1500778Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries)
    Uniprot P09960
  8. 1500810Domain d3fuda3: 3fud A:461-609 [210151]
    Other proteins in same PDB: d3fuda1, d3fuda2
    automated match to d1hs6a1
    complexed with 692, act, imd, yb, zn

Details for d3fuda3

PDB Entry: 3fud (more details), 2.2 Å

PDB Description: leukotriene a4 hydrolase in complex with n-methyl-1-(2-thiophen-2- ylphenyl)methanamine
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fuda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fuda3 a.118.1.7 (A:461-609) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkv

SCOPe Domain Coordinates for d3fuda3:

Click to download the PDB-style file with coordinates for d3fuda3.
(The format of our PDB-style files is described here.)

Timeline for d3fuda3: