Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries) Uniprot P09960 |
Domain d3fuda3: 3fud A:461-609 [210151] Other proteins in same PDB: d3fuda1, d3fuda2 automated match to d1hs6a1 complexed with 692, act, imd, yb, zn |
PDB Entry: 3fud (more details), 2.2 Å
SCOPe Domain Sequences for d3fuda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fuda3 a.118.1.7 (A:461-609) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkv
Timeline for d3fuda3: