| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
| Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63610] (58 PDB entries) Uniprot P09960 |
| Domain d3ftza3: 3ftz A:461-609 [210118] Other proteins in same PDB: d3ftza1, d3ftza2 automated match to d1hs6a1 complexed with 848, act, imd, yb, zn |
PDB Entry: 3ftz (more details), 2 Å
SCOPe Domain Sequences for d3ftza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ftza3 a.118.1.7 (A:461-609) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkv
Timeline for d3ftza3: