SCOPe 2.03: Domain d3fpba4: 3fpb A:361-599

Lineage for d3fpba4 (3fpb A:361-599)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Calcium ATPase [81658] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (37 PDB entries)
   Uniprot P04191

8. Domain d3fpba4: 3fpb A:361-599 [210037]
   Other proteins in same PDB: d3fpba1, d3fpba2, d3fpba3
   automated match to d1wpga3
   complexed with atp, cza, k, mf4, mg

Details for d3fpba4

PDB Entry: 3fpb, 2.55 Å

PDB Description: the structure of sarcoplasmic reticulum ca2+-atpase bound to cyclopiazonic acid with atp

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3fpba4:

Sequence; same for both SEQRES and ATOM records:

>d3fpba4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

Timeline for d3fpba4:

• d3fpba4 is new in SCOPe 2.03-stable
  
• d3fpba4 appears in SCOPe 2.04
  
• d3fpba4 appears in the current release, SCOPe 2.08