Lineage for d3fpba4 (3fpb A:361-599)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007458Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 3007459Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 3007460Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 3007461Protein Calcium ATPase [81658] (1 species)
  7. 3007462Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries)
    Uniprot P04191
  8. 3007505Domain d3fpba4: 3fpb A:361-599 [210037]
    Other proteins in same PDB: d3fpba1, d3fpba2, d3fpba3
    automated match to d1wpga3
    complexed with atp, cza, k, mf4, mg
    has additional insertions and/or extensions that are not grouped together

Details for d3fpba4

PDB Entry: 3fpb (more details), 2.55 Å

PDB Description: the structure of sarcoplasmic reticulum ca2+-atpase bound to cyclopiazonic acid with atp
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3fpba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fpba4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d3fpba4:

Click to download the PDB-style file with coordinates for d3fpba4.
(The format of our PDB-style files is described here.)

Timeline for d3fpba4: