Lineage for d1wpga3 (1wpg A:361-599)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446582Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 1446583Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 1446584Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 1446585Protein Calcium ATPase [81658] (1 species)
  7. 1446586Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (37 PDB entries)
    Uniprot P04191
  8. 1446591Domain d1wpga3: 1wpg A:361-599 [114808]
    Other proteins in same PDB: d1wpga1, d1wpga2, d1wpga4, d1wpgb1, d1wpgb2, d1wpgb4, d1wpgc1, d1wpgc2, d1wpgc4, d1wpgd1, d1wpgd2, d1wpgd4
    complexed with adp, mf4, mg, na, tg1

Details for d1wpga3

PDB Entry: 1wpg (more details), 2.3 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with MGF4
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1wpga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d1wpga3:

Click to download the PDB-style file with coordinates for d1wpga3.
(The format of our PDB-style files is described here.)

Timeline for d1wpga3: