Lineage for d3flco1 (3flc O:3-254)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605693Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1605694Protein Glycerol kinase [53090] (2 species)
  7. 1605695Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 1605704Domain d3flco1: 3flc O:3-254 [210001]
    automated match to d1glfo1
    complexed with gol, so4; mutant

Details for d3flco1

PDB Entry: 3flc (more details), 1.85 Å

PDB Description: crystal structure of the his-tagged h232r mutant of glycerol kinase from enterococcus casseliflavus with glycerol
PDB Compounds: (O:) glycerol kinase

SCOPe Domain Sequences for d3flco1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3flco1 c.55.1.4 (O:3-254) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
eknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvia
gafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdght
emihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvt
dysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyrfygsevpiag
magdqqaalfgq

SCOPe Domain Coordinates for d3flco1:

Click to download the PDB-style file with coordinates for d3flco1.
(The format of our PDB-style files is described here.)

Timeline for d3flco1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3flco2