SCOPe 2.03: Domain d3flco1: 3flc O:3-254

Lineage for d3flco1 (3flc O:3-254)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
   Uniprot O34153 5-491

8. Domain d3flco1: 3flc O:3-254 [210001]
   automated match to d1glfo1
   complexed with gol, so4; mutant

Details for d3flco1

PDB Entry: 3flc, 1.85 Å

PDB Description: crystal structure of the his-tagged h232r mutant of glycerol kinase from enterococcus casseliflavus with glycerol

PDB Compounds: (O:) glycerol kinase

SCOPe Domain Sequences for d3flco1:

Sequence; same for both SEQRES and ATOM records:

>d3flco1 c.55.1.4 (O:3-254) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
eknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvia
gafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdght
emihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvt
dysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyrfygsevpiag
magdqqaalfgq

Timeline for d3flco1:

• d3flco1 is new in SCOPe 2.03-stable
  
• d3flco1 appears in SCOPe 2.04
  
• d3flco1 appears in the current release, SCOPe 2.08