Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (8 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225620] (7 PDB entries) |
Domain d3fj5b_: 3fj5 B: [209952] automated match to d1ynza_ complexed with act, gol, pg4, pge, so4 |
PDB Entry: 3fj5 (more details), 1.65 Å
SCOPe Domain Sequences for d3fj5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fj5b_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
Timeline for d3fj5b_: