SCOPe 2.06: Domain d3fixc1: 3fix C:1-159

Lineage for d3fixc1 (3fix C:1-159)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [225555] (4 PDB entries)

8. Domain d3fixc1: 3fix C:1-159 [209942]
   Other proteins in same PDB: d3fixa2, d3fixc2
   automated match to d1tiqa_
   complexed with edo

Details for d3fixc1

PDB Entry: 3fix, 2.3 Å

PDB Description: crystal structure of a putative n-acetyltransferase (ta0374) from thermoplasma acidophilum

PDB Compounds: (C:) n-acetyltransferase

SCOPe Domain Sequences for d3fixc1:

Sequence; same for both SEQRES and ATOM records:

>d3fixc1 d.108.1.0 (C:1-159) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsn
ldilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgi
lecrlyvhrqnsvgfsfyykngfkvedtdgsdfimekky

Timeline for d3fixc1:

• d3fixc1 first appeared in SCOPe 2.03, called d3fixc_
  
• d3fixc1 was called d3fixc_ in SCOPe 2.05
  
• d3fixc1 appears in SCOPe 2.07
  
• d3fixc1 appears in the current release, SCOPe 2.08