Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries) |
Domain d3fhba2: 3fhb A:322-532 [209922] Other proteins in same PDB: d3fhba1, d3fhba3 automated match to d1gs0a2 complexed with gab |
PDB Entry: 3fhb (more details), 2.3 Å
SCOPe Domain Sequences for d3fhba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fhba2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]} lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp cpefssstfsqseyliyqesqcrlryllevh
Timeline for d3fhba2: