Lineage for d3fhba2 (3fhb A:322-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234210Domain d3fhba2: 3fhb A:322-532 [209922]
    Other proteins in same PDB: d3fhba1, d3fhba3
    automated match to d1gs0a2
    complexed with gab

Details for d3fhba2

PDB Entry: 3fhb (more details), 2.3 Å

PDB Description: human poly(adp-ribose) polymerase 3, catalytic fragment in complex with an inhibitor 3-aminobenzoic acid
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d3fhba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhba2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl
lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl
gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp
cpefssstfsqseyliyqesqcrlryllevh

SCOPe Domain Coordinates for d3fhba2:

Click to download the PDB-style file with coordinates for d3fhba2.
(The format of our PDB-style files is described here.)

Timeline for d3fhba2: