SCOPe 2.07: Domain d3fhba2: 3fhb A:322-532

Lineage for d3fhba2 (3fhb A:322-532)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d3fhba2: 3fhb A:322-532 [209922]
   Other proteins in same PDB: d3fhba1, d3fhba3
   automated match to d1gs0a2
   complexed with gab

Details for d3fhba2

PDB Entry: 3fhb, 2.3 Å

PDB Description: human poly(adp-ribose) polymerase 3, catalytic fragment in complex with an inhibitor 3-aminobenzoic acid

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d3fhba2:

Sequence; same for both SEQRES and ATOM records:

>d3fhba2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl
lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl
gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp
cpefssstfsqseyliyqesqcrlryllevh

Timeline for d3fhba2:

• d3fhba2 first appeared in SCOPe 2.03
  
• d3fhba2 appears in SCOPe 2.06
  
• d3fhba2 appears in the current release, SCOPe 2.08