Lineage for d3fduc1 (3fdu C:10-247)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113067Species Acinetobacter baumannii [TaxId:400667] [225573] (1 PDB entry)
  8. 2113070Domain d3fduc1: 3fdu C:10-247 [209866]
    Other proteins in same PDB: d3fdua2, d3fdub2, d3fduc2, d3fdud2
    automated match to d3peaf_
    complexed with gol, so4

Details for d3fduc1

PDB Entry: 3fdu (more details), 2 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii
PDB Compounds: (C:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3fduc1:

Sequence, based on SEQRES records: (download)

>d3fduc1 c.14.1.0 (C:10-247) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdft
agndmkdfmgfvqnpnagpagqvppfvllksaarlskpliiavkgvaigigvtillqadl
vfadntalfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvne
ivedayataqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspem

Sequence, based on observed residues (ATOM records): (download)

>d3fduc1 c.14.1.0 (C:10-247) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdft
agndmkpagqvppfvllksaarlskpliiavkgvaigigvtillqadlvfadntalfqip
fvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvneivedayataqat
aqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspem

SCOPe Domain Coordinates for d3fduc1:

Click to download the PDB-style file with coordinates for d3fduc1.
(The format of our PDB-style files is described here.)

Timeline for d3fduc1: