Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Acinetobacter baumannii [TaxId:400667] [225573] (1 PDB entry) |
Domain d3fduc_: 3fdu C: [209866] automated match to d3peaf_ complexed with gol, so4 |
PDB Entry: 3fdu (more details), 2 Å
SCOPe Domain Sequences for d3fduc_:
Sequence, based on SEQRES records: (download)
>d3fduc_ c.14.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 400667]} lhphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdf tagndmkdfmgfvqnpnagpagqvppfvllksaarlskpliiavkgvaigigvtillqad lvfadntalfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvn eivedayataqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspem
>d3fduc_ c.14.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 400667]} lhphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdf tagndmkpagqvppfvllksaarlskpliiavkgvaigigvtillqadlvfadntalfqi pfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvneivedayataqa taqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspem
Timeline for d3fduc_: