SCOPe 2.04: Domain d3exva_: 3exv A:

Lineage for d3exva_ (3exv A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (8 species)

7. Species Human adenovirus b [TaxId:108098] [226821] (1 PDB entry)

8. Domain d3exva_: 3exv A: [209727]
   automated match to d3f0ya_

Details for d3exva_

PDB Entry: 3exv, 1.45 Å

PDB Description: crystal structure of the human adenovirus type 11 fiber knob

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d3exva_:

Sequence; same for both SEQRES and ATOM records:

>d3exva_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus b [TaxId: 108098]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd

Timeline for d3exva_:

• d3exva_ first appeared in SCOPe 2.03
  
• d3exva_ appears in SCOPe 2.05
  
• d3exva_ appears in the current release, SCOPe 2.08