Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
Species Human adenovirus b [TaxId:108098] [226821] (1 PDB entry) |
Domain d3exva_: 3exv A: [209727] automated match to d3f0ya_ |
PDB Entry: 3exv (more details), 1.45 Å
SCOPe Domain Sequences for d3exva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exva_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus b [TaxId: 108098]} dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa ttlvtspftfyyiredd
Timeline for d3exva_: