SCOPe 2.04: Domain d3evkc1: 3evk C:12-103

Lineage for d3evkc1 (3evk C:12-103)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [100984] (2 PDB entries)

8. Domain d3evkc1: 3evk C:12-103 [209679]
   Other proteins in same PDB: d3evka2, d3evkb2, d3evkc2, d3evkd2
   automated match to d1p7ga1
   complexed with mn

Details for d3evkc1

PDB Entry: 3evk, 1.85 Å

PDB Description: Crystal structure of the metal-bound superoxide dismutase from Pyrobaculum aerophilum

PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3evkc1:

Sequence; same for both SEQRES and ATOM records:

>d3evkc1 a.2.11.1 (C:12-103) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
svttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqi
diravlrdlsfhlnghilhsifwpnmappgkg

Timeline for d3evkc1:

• d3evkc1 first appeared in SCOPe 2.03
  
• d3evkc1 appears in SCOPe 2.05
  
• d3evkc1 appears in the current release, SCOPe 2.08