Lineage for d3evkb1 (3evk B:12-103)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476277Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1476278Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1476306Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 1476360Species Pyrobaculum aerophilum [TaxId:13773] [100984] (2 PDB entries)
  8. 1476386Domain d3evkb1: 3evk B:12-103 [209677]
    Other proteins in same PDB: d3evka2, d3evkb2, d3evkc2, d3evkd2
    automated match to d1p7ga1
    complexed with mn

Details for d3evkb1

PDB Entry: 3evk (more details), 1.85 Å

PDB Description: Crystal structure of the metal-bound superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3evkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evkb1 a.2.11.1 (B:12-103) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
svttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqi
diravlrdlsfhlnghilhsifwpnmappgkg

SCOPe Domain Coordinates for d3evkb1:

Click to download the PDB-style file with coordinates for d3evkb1.
(The format of our PDB-style files is described here.)

Timeline for d3evkb1: