Lineage for d3evkb2 (3evk B:104-222)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189807Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2189808Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2189809Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2189837Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 2189891Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries)
  8. 2189917Domain d3evkb2: 3evk B:104-222 [209678]
    Other proteins in same PDB: d3evka1, d3evka3, d3evkb1, d3evkb3, d3evkc1, d3evkc3, d3evkd1, d3evkd3
    automated match to d1p7ga2
    complexed with mn

Details for d3evkb2

PDB Entry: 3evk (more details), 1.85 Å

PDB Description: Crystal structure of the metal-bound superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3evkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evkb2 d.44.1.1 (B:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

SCOPe Domain Coordinates for d3evkb2:

Click to download the PDB-style file with coordinates for d3evkb2.
(The format of our PDB-style files is described here.)

Timeline for d3evkb2: