SCOPe 2.08: Domain d3evkb2: 3evk B:104-222

Lineage for d3evkb2 (3evk B:104-222)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [102926] (2 PDB entries)

8. Domain d3evkb2: 3evk B:104-222 [209678]
   Other proteins in same PDB: d3evka1, d3evka3, d3evkb1, d3evkb3, d3evkc1, d3evkc3, d3evkd1, d3evkd3
   automated match to d1p7ga2
   complexed with mn

Details for d3evkb2

PDB Entry: 3evk, 1.85 Å

PDB Description: Crystal structure of the metal-bound superoxide dismutase from Pyrobaculum aerophilum

PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3evkb2:

Sequence; same for both SEQRES and ATOM records:

>d3evkb2 d.44.1.1 (B:104-222) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

Timeline for d3evkb2:

• d3evkb2 first appeared in SCOPe 2.03
  
• d3evkb2 appears in SCOPe 2.07