![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [46611] (10 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [100984] (2 PDB entries) |
![]() | Domain d3evka1: 3evk A:13-103 [209675] Other proteins in same PDB: d3evka2, d3evka3, d3evkb2, d3evkb3, d3evkc2, d3evkc3, d3evkd2, d3evkd3 automated match to d1p7ga1 complexed with mn |
PDB Entry: 3evk (more details), 1.85 Å
SCOPe Domain Sequences for d3evka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3evka1 a.2.11.1 (A:13-103) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]} vttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqid iravlrdlsfhlnghilhsifwpnmappgkg
Timeline for d3evka1: