Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
Protein automated matches [190146] (12 species) not a true protein |
Species Avian infectious bronchitis virus (strain beaudette) [TaxId:11120] [196077] (2 PDB entries) |
Domain d3ekea_: 3eke A: [209543] automated match to d3ejfa_ complexed with tla |
PDB Entry: 3eke (more details), 2.1 Å
SCOPe Domain Sequences for d3ekea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ekea_ c.50.1.0 (A:) automated matches {Avian infectious bronchitis virus (strain beaudette) [TaxId: 11120]} atcekpkfleyktcvgdltvviakaldefkefcivnaanehmthgsgvakaiadfcgldf veycedyvkkhgpqqrlvtpsfvkgiqcvnnvvgprhgdnnlheklvaayknvlvdgvvn yvvpvlslgifgvdfkmsidamreafegctirvllfslsqehidyfdvtck
Timeline for d3ekea_: