| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
| Domain d2ig2h2: 2ig2 H:120-231 [20953] Other proteins in same PDB: d2ig2h1, d2ig2l1, d2ig2l2 part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure |
PDB Entry: 2ig2 (more details), 3 Å
SCOPe Domain Sequences for d2ig2h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig2h2 b.1.1.2 (H:120-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcp
Timeline for d2ig2h2: