![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) |
![]() | Domain d2ig2l2: 2ig2 L:110-214 [20952] Other proteins in same PDB: d2ig2h1, d2ig2h2, d2ig2l1 part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure |
PDB Entry: 2ig2 (more details), 3 Å
SCOPe Domain Sequences for d2ig2l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig2l2 b.1.1.2 (L:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d2ig2l2: