Lineage for d3ef2a1 (3ef2 A:2-155)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2061887Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2061899Protein Agglutinin MOA, N-terminal domain [159152] (1 species)
  7. 2061900Species Fairy-ring mushroom (Marasmius oreades) [TaxId:181124] [159153] (2 PDB entries)
    Uniprot Q8X123 2-155
  8. 2061901Domain d3ef2a1: 3ef2 A:2-155 [209474]
    Other proteins in same PDB: d3ef2a2, d3ef2b2, d3ef2c2, d3ef2d2
    automated match to d2ihoa1
    complexed with act, ca

Details for d3ef2a1

PDB Entry: 3ef2 (more details), 1.8 Å

PDB Description: structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d3ef2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ef2a1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]}
slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
vdlvngdssdgakiagwtgtwdegnphqkwyfnr

SCOPe Domain Coordinates for d3ef2a1:

Click to download the PDB-style file with coordinates for d3ef2a1.
(The format of our PDB-style files is described here.)

Timeline for d3ef2a1: