SCOP 1.69: Domain d1dn0a2: 1dn0 A:108-215

Lineage for d1dn0a2 (1dn0 A:108-215)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1dn0a2: 1dn0 A:108-215 [20934]
Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0b2, d1dn0c1, d1dn0d1, d1dn0d2

Details for d1dn0a2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0a2 b.1.1.2 (A:108-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1dn0a2:

Click to download the PDB-style file with coordinates for d1dn0a2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0a2: