Lineage for d1dn0a2 (1dn0 A:108-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9012Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries)
  8. 9013Domain d1dn0a2: 1dn0 A:108-215 [20934]
    Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0c1, d1dn0d1

Details for d1dn0a2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0a2 b.1.1.2 (A:108-215) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1dn0a2:

Click to download the PDB-style file with coordinates for d1dn0a2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0a2: