Lineage for d3dvxa_ (3dvx A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1603067Species Neisseria meningitidis [TaxId:122586] [196549] (3 PDB entries)
  8. 1603070Domain d3dvxa_: 3dvx A: [209325]
    automated match to d3a3tf_
    complexed with so4

Details for d3dvxa_

PDB Entry: 3dvx (more details), 2.8 Å

PDB Description: Crystal structure of reduced DsbA3 from Neisseria meningitidis
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3dvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvxa_ c.47.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
gyaltegedylvldkpipqeqsgkievleffgyfcvhchhfdplllklgkalpsdaylrt
ehvvwqpemlglarmaaavnlsglkyqanpavfkavyeqkirlenrsvagkwalsqkgfd
gkklmraydspeaaaaalkmqklteqyridstptvivggkyrvifnngfdggvhtikelv
akvreerkrqt

SCOPe Domain Coordinates for d3dvxa_:

Click to download the PDB-style file with coordinates for d3dvxa_.
(The format of our PDB-style files is described here.)

Timeline for d3dvxa_: