SCOPe 2.05: Domain d3dvxa_: 3dvx A:

Lineage for d3dvxa_ (3dvx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [196549] (3 PDB entries)

8. Domain d3dvxa_: 3dvx A: [209325]
   automated match to d3a3tf_
   complexed with so4

Details for d3dvxa_

PDB Entry: 3dvx, 2.8 Å

PDB Description: Crystal structure of reduced DsbA3 from Neisseria meningitidis

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3dvxa_:

Sequence; same for both SEQRES and ATOM records:

>d3dvxa_ c.47.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
gyaltegedylvldkpipqeqsgkievleffgyfcvhchhfdplllklgkalpsdaylrt
ehvvwqpemlglarmaaavnlsglkyqanpavfkavyeqkirlenrsvagkwalsqkgfd
gkklmraydspeaaaaalkmqklteqyridstptvivggkyrvifnngfdggvhtikelv
akvreerkrqt

Timeline for d3dvxa_:

• d3dvxa_ first appeared in SCOPe 2.03
  
• d3dvxa_ appears in SCOPe 2.04
  
• d3dvxa_ is called d3dvxa1 in SCOPe 2.06
  
• d3dvxa_ appears in the current release, SCOPe 2.08, called d3dvxa1