SCOP 1.71: Domain d1igjb2: 1igj B:115-227

Lineage for d1igjb2 (1igj B:115-227)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1igjb2: 1igj B:115-227 [20929]
   Other proteins in same PDB: d1igja1, d1igja2, d1igjb1, d1igjc1, d1igjc2, d1igjd1

Details for d1igjb2

PDB Entry: 1igj, 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjb2:

Sequence; same for both SEQRES and ATOM records:

>d1igjb2 b.1.1.2 (B:115-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1igjb2:

• d1igjb2 first appeared (with stable ids) in SCOP 1.55
  
• d1igjb2 appears in SCOP 1.69
  
• d1igjb2 appears in SCOP 1.73
  
• d1igjb2 appears in the current release, SCOPe 2.08