SCOP 1.71: Domain d1igjc1: 1igj C:1-107

Lineage for d1igjc1 (1igj C:1-107)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
Domain d1igjc1: 1igj C:1-107 [19820]
Other proteins in same PDB: d1igja2, d1igjb1, d1igjb2, d1igjc2, d1igjd1, d1igjd2
part of Fab 26-10
complexed with dgx

Details for d1igjc1

PDB Entry: 1igj (more details), 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igjc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleik

SCOP Domain Coordinates for d1igjc1:

Click to download the PDB-style file with coordinates for d1igjc1.
(The format of our PDB-style files is described here.)

Timeline for d1igjc1: