SCOP 1.55: Domain d1igjb2: 1igj B:115-227

Lineage for d1igjb2 (1igj B:115-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 26-10 (mouse), kappa L chain [48984] (2 PDB entries)

8. Domain d1igjb2: 1igj B:115-227 [20929]
   Other proteins in same PDB: d1igja1, d1igjb1, d1igjc1, d1igjd1

Details for d1igjb2

PDB Entry: 1igj, 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjb2:

Sequence; same for both SEQRES and ATOM records:

>d1igjb2 b.1.1.2 (B:115-227) Immunoglobulin (constant domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

Timeline for d1igjb2:

• d1igjb2 appears in SCOP 1.57
  
• d1igjb2 appears in the current release, SCOPe 2.08