Lineage for d3ds2a_ (3ds2 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487604Protein HIV capsid protein, dimerisation domain [47359] (1 species)
  7. 1487605Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (14 PDB entries)
  8. 1487606Domain d3ds2a_: 3ds2 A: [209283]
    automated match to d1baja_
    mutant

Details for d3ds2a_

PDB Entry: 3ds2 (more details), 1.2 Å

PDB Description: hiv-1 capsid c-terminal domain mutant (y169a)
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d3ds2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ds2a_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfaktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d3ds2a_:

Click to download the PDB-style file with coordinates for d3ds2a_.
(The format of our PDB-style files is described here.)

Timeline for d3ds2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ds2b_