Lineage for d3dqwb_ (3dqw B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672024Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 1672025Species Chicken (Gallus gallus) [TaxId:9031] [56157] (35 PDB entries)
  8. 1672030Domain d3dqwb_: 3dqw B: [209259]
    automated match to d2gqgb_
    complexed with ags, mg; mutant

Details for d3dqwb_

PDB Entry: 3dqw (more details), 2.02 Å

PDB Description: c-src kinase domain thr338ile mutant in complex with atpgs
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d3dqwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqwb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
kklrheklvqlyavvseepiyivieymskgslldflkgemgkylrlpqlvdmaaqiasgm
ayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaa
lygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdl
mcqcwrkdpeerptfeylqafledyftstepqyqpgenl

SCOPe Domain Coordinates for d3dqwb_:

Click to download the PDB-style file with coordinates for d3dqwb_.
(The format of our PDB-style files is described here.)

Timeline for d3dqwb_: