SCOPe 2.06: Domain d3dl2a1: 3dl2 A:171-318

Lineage for d3dl2a1 (3dl2 A:171-318)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d3dl2a1: 3dl2 A:171-318 [209222]
   Other proteins in same PDB: d3dl2a2, d3dl2a3, d3dl2b2, d3dl2b3
   automated match to d1ez4a1
   complexed with na, po4

Details for d3dl2a1

PDB Entry: 3dl2, 2.1 Å

PDB Description: Hexagonal structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 3

SCOPe Domain Sequences for d3dl2a1:

Sequence, based on SEQRES records:

>d3dl2a1 c.2.1.0 (A:171-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifn
lpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsvll
vasqpveimtyvtwklstfpanrvigig

Sequence, based on observed residues (ATOM records):

>d3dl2a1 c.2.1.0 (A:171-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skstvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnveis
kdlsasahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimty
vtwklstfpanrvigig

Timeline for d3dl2a1:

• d3dl2a1 first appeared in SCOPe 2.03
  
• d3dl2a1 appears in SCOPe 2.05
  
• d3dl2a1 appears in SCOPe 2.07
  
• d3dl2a1 appears in the current release, SCOPe 2.08