Lineage for d3dl2a1 (3dl2 A:171-318)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847056Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)
  8. 2847080Domain d3dl2a1: 3dl2 A:171-318 [209222]
    Other proteins in same PDB: d3dl2a2, d3dl2a3, d3dl2b2, d3dl2b3
    automated match to d1ez4a1
    complexed with na, po4

Details for d3dl2a1

PDB Entry: 3dl2 (more details), 2.1 Å

PDB Description: Hexagonal structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 variant 3

SCOPe Domain Sequences for d3dl2a1:

Sequence, based on SEQRES records: (download)

>d3dl2a1 c.2.1.0 (A:171-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifn
lpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsvll
vasqpveimtyvtwklstfpanrvigig

Sequence, based on observed residues (ATOM records): (download)

>d3dl2a1 c.2.1.0 (A:171-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skstvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnveis
kdlsasahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimty
vtwklstfpanrvigig

SCOPe Domain Coordinates for d3dl2a1:

Click to download the PDB-style file with coordinates for d3dl2a1.
(The format of our PDB-style files is described here.)

Timeline for d3dl2a1: