| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (52 species) not a true protein |
| Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry) |
| Domain d3djcb2: 3djc B:123-255 [209185] Other proteins in same PDB: d3djca3, d3djcb3, d3djcc3, d3djcd3, d3djce3, d3djcf3, d3djcg3, d3djch3, d3djci3, d3djcj3, d3djck3, d3djcl3 automated match to d3bexa2 complexed with gol |
PDB Entry: 3djc (more details), 2.4 Å
SCOPe Domain Sequences for d3djcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3djcb2 c.55.1.0 (B:123-255) automated matches {Legionella pneumophila [TaxId: 272624]}
qniividfgtattfcaishkkaylggailpglrlsadalskntaklpsveiiktesvvgr
stiesiqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhlvpdl
vlqgirlaammnt
Timeline for d3djcb2:
View in 3DDomains from other chains: (mouse over for more information) d3djca1, d3djca2, d3djca3, d3djcc1, d3djcc2, d3djcc3, d3djcd1, d3djcd2, d3djcd3, d3djce1, d3djce2, d3djce3, d3djcf1, d3djcf2, d3djcf3, d3djcg1, d3djcg2, d3djcg3, d3djch1, d3djch2, d3djch3, d3djci1, d3djci2, d3djci3, d3djcj1, d3djcj2, d3djcj3, d3djck1, d3djck2, d3djck3, d3djcl1, d3djcl2, d3djcl3 |