Lineage for d3djcd2 (3djc D:123-256)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138770Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry)
  8. 2138778Domain d3djcd2: 3djc D:123-256 [209189]
    Other proteins in same PDB: d3djca3, d3djcb3, d3djcc3, d3djcd3, d3djce3, d3djcf3, d3djcg3, d3djch3, d3djci3, d3djcj3, d3djck3, d3djcl3
    automated match to d3bexa2
    complexed with gol

Details for d3djcd2

PDB Entry: 3djc (more details), 2.4 Å

PDB Description: crystal structure of pantothenate kinase from legionella pneumophila
PDB Compounds: (D:) Type III pantothenate kinase

SCOPe Domain Sequences for d3djcd2:

Sequence, based on SEQRES records: (download)

>d3djcd2 c.55.1.0 (D:123-256) automated matches {Legionella pneumophila [TaxId: 272624]}
qniividfgtattfcaishkkaylggailpglrlsadalskntaklpsveiiktesvvgr
stiesiqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhlvpdl
vlqgirlaammnta

Sequence, based on observed residues (ATOM records): (download)

>d3djcd2 c.55.1.0 (D:123-256) automated matches {Legionella pneumophila [TaxId: 272624]}
qniividfgtattfcaishkkaylggailpglrlsadalskntasveiiktesvvgrsti
esiqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhlvpdlvlq
girlaammnta

SCOPe Domain Coordinates for d3djcd2:

Click to download the PDB-style file with coordinates for d3djcd2.
(The format of our PDB-style files is described here.)

Timeline for d3djcd2: