Lineage for d3dgqb2 (3dgq B:77-209)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735942Protein Class pi GST [81347] (4 species)
  7. 1735943Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
  8. 1735949Domain d3dgqb2: 3dgq B:77-209 [209175]
    Other proteins in same PDB: d3dgqa1, d3dgqb1
    automated match to d13gsa1
    complexed with ca, cl, eaa, mes, so4

Details for d3dgqb2

PDB Entry: 3dgq (more details), 1.6 Å

PDB Description: Crystal structure of the glutathione transferase PI enzyme in complex with the bifunctional inhibitor, etharapta
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3dgqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgqb2 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d3dgqb2:

Click to download the PDB-style file with coordinates for d3dgqb2.
(The format of our PDB-style files is described here.)

Timeline for d3dgqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dgqb1