Lineage for d3dera1 (3der A:3-124)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555506Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries)
  8. 2555511Domain d3dera1: 3der A:3-124 [209105]
    Other proteins in same PDB: d3dera2, d3derb2, d3derc2, d3derd2
    automated match to d1jpma2
    complexed with ala, mg

Details for d3dera1

PDB Entry: 3der (more details), 1.9 Å

PDB Description: Crystal structure of dipeptide epimerase from Thermotoga maritima complexed with L-Ala-L-Lys dipeptide
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dera1 d.54.1.0 (A:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg

SCOPe Domain Coordinates for d3dera1:

Click to download the PDB-style file with coordinates for d3dera1.
(The format of our PDB-style files is described here.)

Timeline for d3dera1: