| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (94 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries) |
| Domain d3derc1: 3der C:3-124 [209109] Other proteins in same PDB: d3dera2, d3derb2, d3derc2, d3derd2 automated match to d1jpma2 complexed with ala, mg |
PDB Entry: 3der (more details), 1.9 Å
SCOPe Domain Sequences for d3derc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3derc1 d.54.1.0 (C:3-124) automated matches {Thermotoga maritima [TaxId: 243274]}
rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea
llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll
gg
Timeline for d3derc1: