Lineage for d3dc2b4 (3dc2 B:452-529)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954060Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 2954061Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 2954082Species Mycobacterium tuberculosis [TaxId:1773] [143374] (2 PDB entries)
    Uniprot P0A544 451-528
    there is an intervening domain between the substrate-binding domain and this domain
  8. 2954084Domain d3dc2b4: 3dc2 B:452-529 [209078]
    Other proteins in same PDB: d3dc2a1, d3dc2a2, d3dc2a3, d3dc2b1, d3dc2b2, d3dc2b3
    automated match to d1ygya3
    complexed with ser, tla

Details for d3dc2b4

PDB Entry: 3dc2 (more details), 2.7 Å

PDB Description: Crystal structure of serine bound D-3-phosphoglycerate dehydrogenase from Mycobacterium tuberculosis
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d3dc2b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dc2b4 d.58.18.1 (B:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}
aqginliihyvdrpgalgkigtllgtagvniqaaqlsedaegpgatillrldqdvpddvr
taiaaavdayklevvdls

SCOPe Domain Coordinates for d3dc2b4:

Click to download the PDB-style file with coordinates for d3dc2b4.
(The format of our PDB-style files is described here.)

Timeline for d3dc2b4: