Lineage for d3dc2b3 (3dc2 B:317-451)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527738Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) (S)
    contains extra C-terminal beta-hairpin
  5. 2527747Family d.81.2.2: SerA intervening domain-like [143552] (1 protein)
    PfamB PB001360; this domain is found in some but not all D-3-phosphoglycerate dehydrogenases (SerA) and related enzymes
  6. 2527748Protein D-3-phosphoglycerate dehydrogenase SerA [143553] (1 species)
  7. 2527749Species Mycobacterium tuberculosis [TaxId:1773] [143554] (2 PDB entries)
    Uniprot P0A544 316-450
  8. 2527753Domain d3dc2b3: 3dc2 B:317-451 [209077]
    Other proteins in same PDB: d3dc2a1, d3dc2a2, d3dc2a4, d3dc2b1, d3dc2b2, d3dc2b4
    automated match to d1ygya4
    complexed with ser, tla

Details for d3dc2b3

PDB Entry: 3dc2 (more details), 2.7 Å

PDB Description: Crystal structure of serine bound D-3-phosphoglycerate dehydrogenase from Mycobacterium tuberculosis
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d3dc2b3:

Sequence, based on SEQRES records: (download)

>d3dc2b3 d.81.2.2 (B:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]}
ggvvneevapwldlvrklgvlagvlsdelpvslsvqvrgelaaeevevlrlsalrglfsa
viedavtfvnapalaaergvtaeickasespnhrsvvdvravgadgsvvtvsgtlygpql
sqkivqingrhfdlr

Sequence, based on observed residues (ATOM records): (download)

>d3dc2b3 d.81.2.2 (B:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]}
ggvvneevapwldlvrklgvlagvlsdelpvslsvqvrgelaaeevevlrlsalrglfsa
vietfvnapalaaergvtaeickasespnhrsvvdvravgadgsvvtvsgtlygpqlsqk
ivqingrhfdlr

SCOPe Domain Coordinates for d3dc2b3:

Click to download the PDB-style file with coordinates for d3dc2b3.
(The format of our PDB-style files is described here.)

Timeline for d3dc2b3: