Lineage for d3dc2b1 (3dc2 B:4-98,B:283-316)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857660Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 2857684Protein Phosphoglycerate dehydrogenase [52293] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 2857705Species Mycobacterium tuberculosis [TaxId:1773] [142063] (2 PDB entries)
    Uniprot P0A544 2-97,282-315
    there is an intervening domain between this domain and regulatory (C-terminal) domain
  8. 2857707Domain d3dc2b1: 3dc2 B:4-98,B:283-316 [209075]
    Other proteins in same PDB: d3dc2a2, d3dc2a3, d3dc2a4, d3dc2b2, d3dc2b3, d3dc2b4
    automated match to d1ygya2
    complexed with ser, tla

Details for d3dc2b1

PDB Entry: 3dc2 (more details), 2.7 Å

PDB Description: Crystal structure of serine bound D-3-phosphoglycerate dehydrogenase from Mycobacterium tuberculosis
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d3dc2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dc2b1 c.23.12.1 (B:4-98,B:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
lpvvliadklapstvaalgdqvevrwvdgpdrdkllaavpeadallvrsattvdaevlaa
apklkivaragvgldnvdvdaatargvlvvnaptsXastaeaqdragtdvaesvrlalag
efvpdavnvg

SCOPe Domain Coordinates for d3dc2b1:

Click to download the PDB-style file with coordinates for d3dc2b1.
(The format of our PDB-style files is described here.)

Timeline for d3dc2b1: