SCOPe 2.06: Domain d3d5ua_: 3d5u A:

Lineage for d3d5ua_ (3d5u A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (8 PDB entries)

8. Domain d3d5ua_: 3d5u A: [209010]
   automated match to d4gcja_

Details for d3d5ua_

PDB Entry: 3d5u, 2.8 Å

PDB Description: Crystal structure of a wildtype Polo-like kinase 1 (Plk1) catalytic domain.

PDB Compounds: (A:) Polo-like kinase 1

SCOPe Domain Sequences for d3d5ua_:

Sequence; same for both SEQRES and ATOM records:

>d3d5ua_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lkeipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqke
kmsteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyf
mrqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkktlcgtpn
yiapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinp
vasalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvppr

Timeline for d3d5ua_:

• d3d5ua_ first appeared in SCOPe 2.03
  
• d3d5ua_ appears in SCOPe 2.05
  
• d3d5ua_ appears in SCOPe 2.07
  
• d3d5ua_ appears in the current release, SCOPe 2.08