Lineage for d3d5ua_ (3d5u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2987449Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (8 PDB entries)
  8. 2987452Domain d3d5ua_: 3d5u A: [209010]
    automated match to d4gcja_

Details for d3d5ua_

PDB Entry: 3d5u (more details), 2.8 Å

PDB Description: Crystal structure of a wildtype Polo-like kinase 1 (Plk1) catalytic domain.
PDB Compounds: (A:) Polo-like kinase 1

SCOPe Domain Sequences for d3d5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ua_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lkeipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqke
kmsteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyf
mrqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkktlcgtpn
yiapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinp
vasalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvppr

SCOPe Domain Coordinates for d3d5ua_:

Click to download the PDB-style file with coordinates for d3d5ua_.
(The format of our PDB-style files is described here.)

Timeline for d3d5ua_: