Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.0: automated matches [227136] (1 protein) not a true family |
Protein automated matches [226838] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224982] (3 PDB entries) |
Domain d3cb2b1: 3cb2 B:3-246 [208846] Other proteins in same PDB: d3cb2a2, d3cb2b2 automated match to d1tubb1 complexed with gdp |
PDB Entry: 3cb2 (more details), 2.3 Å
SCOPe Domain Sequences for d3cb2b1:
Sequence, based on SEQRES records: (download)
>d3cb2b1 c.32.1.0 (B:3-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} reiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyip ravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifdii dreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdvv vqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsasttt lryp
>d3cb2b1 c.32.1.0 (B:3-246) automated matches {Human (Homo sapiens) [TaxId: 9606]} reiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyip ravlldleprvihsilnspyaklynpeniylsehgagnnwasgfsqgekihedifdiidr eadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdvvvq pynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastttlr yp
Timeline for d3cb2b1: