Lineage for d3cb2a1 (3cb2 A:2-246)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2472390Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 2472391Protein automated matches [226838] (4 species)
    not a true protein
  7. 2472410Species Human (Homo sapiens) [TaxId:9606] [224982] (3 PDB entries)
  8. 2472411Domain d3cb2a1: 3cb2 A:2-246 [208844]
    Other proteins in same PDB: d3cb2a2, d3cb2b2
    automated match to d1tubb1
    complexed with gdp

Details for d3cb2a1

PDB Entry: 3cb2 (more details), 2.3 Å

PDB Description: Crystal structure of human gamma-tubulin bound to GDP
PDB Compounds: (A:) Tubulin gamma-1 chain

SCOPe Domain Sequences for d3cb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cb2a1 c.32.1.0 (A:2-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
preiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyi
pravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifdi
idreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdv
vvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastt
tlryp

SCOPe Domain Coordinates for d3cb2a1:

Click to download the PDB-style file with coordinates for d3cb2a1.
(The format of our PDB-style files is described here.)

Timeline for d3cb2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cb2a2